Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP547012-16     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 16_UNE_Kris_11 Museum ID:
  Field ID: 16_UNE_Kris_11 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Chordata Subfamily: Alosinae
  Class: Actinopterygii Genus: Alosa
  Order: Clupeiformes Species: Alosa pseudoharengus
  Family: Clupeidae Subspecies:
  BIN (Cluster ID): BOLD:AAB1380
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction: S
  Tissue Descriptor: Muscle Sex:
  Brief Note: Alewife, Kristin, DL1,DL2 Life Stage:
  Detailed Notes: ::meta:{"specimen":["Kristen Eugley"],"image":["Kristen Eugley"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Deborah Landry"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Kristen Eugley"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2016-07-25
  Province/State: Maine Collectors: Kristen Eugley
  Region/County: Saco River    
  Sector:    
  Exact Site: Freddie's Beach    
  Latitude: 43.46 Elevation:
  Longitude: -70.38 Elv. Accuracy:
  Coord. Source: Depth: 1 Meters
  Coord. Accuracy: 5 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP547012-16.COI-5P GenBank Accession: KY250724
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 652 bp
 
CCTTTACCTAGTATTTGGTGCCTGAGCAGGGATAGTAGGCACTGCCTTAAGTCTCTTAATCCGAGCAGAACTGAG
CCAACCCGGGGCACTTCTCGGAGACGATCAGATCTATAACGTCATCGTTACGGCGCACGCCTTCGTAATAATCTT
CTTCATAGTAATGCCAATTCTAATTGGTGGCTTTGGGAACTGACTAGTCCCCCTTATGATCGGGGCACCAGACAT
GGCATTCCCACGAATGAACAACATGAGCTTCTGACTACTTCCGCCCTCATTCCTCCTCCTTCTTGCCTCATCCGG
GGTTGAGGCCGGGGCAGGAACCGGATGAACAGTCTACCCGCCCTTGGCAGGTAATCTTGCCCACGCCGGAGCGTC
CGTCGATCTAACTATCTTCTCTCTTCATCTAGCGGGTATCTCATCAATTCTTGGGGCCATTAATTTTATTACCAC
AATTATTAATATGAAACCCCCTGCAATCTCACAATATCAAACACCCCTATTTGTGTGATCCGTGCTTGTAACGGC
CGTTCTCCTTCTTCTCTCACTCCCTGTGTTAGCTGCTGGGATTACAATGCTCCTAACAGACCGAAATCTAAATAC
GACCTTCTTTGACCCGGCAGGGGGAGGGGACCCAATTCTATATCAACACCTA
  Amino Acids:  
 
LYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNWLVPLMIGAPDM
AFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILGAINFITT
IINMKPPAISQYQTPLFVWSVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
608 C_FishF1t1 / C_FishR1t1
M13F-20
Forward high qual 2016-08-03  
579 C_FishF1t1 / C_FishR1t1
M13R
Reverse high qual 2016-08-03  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2016)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: Deborah Landry, University of New England
Collectors: Kristen Eugley
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: