Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP396002-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 15_UNE_RD_001 Museum ID:
  Field ID: 15_UNE_RD_001 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Carcininae
  Class: Malacostraca Genus: Carcinus
  Order: Decapoda Species: Carcinus maenas
  Family: Portunidae Subspecies:
  BIN (Cluster ID): BOLD:AAA7687
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: Gr.Crab, RebeccaDailey#3, DL05, DL06 Life Stage:
  Detailed Notes: ::meta:{ specimen :[ Rebecca Dailey ], image :[ Rebecca Dailey ], trace_run_site :[ Generic Commercial Lab ], trace_upload :[ Rebecca Dailey ], sequencing_run_site :[ Generic Commercial Lab ], sequence_upload :[ Rebecca Dailey , Ryan Heuss ]}::endMeta:1.7 cm wide, 1.5 cm long
 
  COLLECTION DATA:
  Country: United States Date Collected: 2015-08-03
  Province/State: Maine Collectors: R. Dailey
  Region/County: Saco River, Maine    
  Sector:    
  Exact Site: Freddie's Beach    
  Latitude: 43.46 Elevation:
  Longitude: -70.379 Elv. Accuracy:
  Coord. Source: Depth: 1 Meters
  Coord. Accuracy: 5 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP396002-15.COI-5P GenBank Accession: KU564520
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 593 bp
 
TGCTTGAGCTGGCATAGTAGGGACTTCTTTGAGTCTTATTATTCGAGCTGAATTAGGGCAGCCAGGAACTTTAAT
CGGTAACGACCAAATTTATAACGTTGTTGTAACTGCTCATGCTTTTGTAATAATTTTTTTCATAGTAATACCAAT
TATAATTGGAGGATTTGGTAATTGACTTGTACCTCTAATATTAGGAGGGCCAGATATAGCTTTTCCTCGAATAAA
TAATATAAGGTTCTGATTACTTCCTCCGTCTTTAACCTTACTTTTAATAAGAGGGATGGTAGAAAGAGGAGTTGG
AACAGGATGAACAGTCTATCCTCCTTTAGCAGGGGCTATCGCCCATGCTGGTGCTTCAGTTGATTTAGGGATTTT
CTCTTTACATTTAGCCGGGGTTTCTTCTATTTTAGGAGCTGTAAATTTTATAACAACTATTATCAATATGCGTTC
TTTCGGCATGACAATAGACCAGATACCTTTATTTGTGTGAGCTGTTTTTATTACTGCGATCCTTTTATTATTATC
GTTGCCGGTTTTAGCAGGAGCTATTACAATACTTCTAACTGACCGAAATCTAAACACCTCATTCGGTC
  Amino Acids:  
 
AWAGMVGTSLSLIIRAELGQPGTLIGNDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGGPDMAFPRMN
NMSFWLLPPSLTLLLMSGMVESGVGTGWTVYPPLAGAIAHAGASVDLGIFSLHLAGVSSILGAVNFMTTIINMRS
FGMTMDQMPLFVWAVFITAILLLLSLPVLAGAITMLLTDRNLNTSFGX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
549 LCO1490 / HCO2198
M13R
Reverse high qual 2015-08-07  
556 LCO1490 / HCO2198
M13F-20
Forward high qual 2015-08-07  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: RDailey, University of New England
Collectors: R. Dailey
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: