Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For USLEP842-10     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 10BBLEP-00842 Museum ID: 10BBLEP-00842
  Field ID: L#2010TX-015 Collection Code:
  Deposited In: Centre for Biodiversity Genomics
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Acontiinae
  Class: Insecta Genus: Tarache
  Order: Lepidoptera Species: Tarache aprica
  Family: Noctuidae Subspecies:
  BIN (Cluster ID): BOLD:AAB8647
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex:
  Brief Note: Life Stage: A
  Detailed Notes: UV light trap|Warm cloudy evening
 
  COLLECTION DATA:
  Country: United States Date Collected: 2010-04-10
  Province/State: Texas Collectors: Biobus 2010
  Region/County:    
  Sector: Hwy 10 Rest Area S-05 10 miles E of Seguin    
  Exact Site: Treed rest area with nature trail    
  Latitude: 29.6173 Elevation: 169 Meters
  Longitude: -97.8076 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
  PUBLICATIONS:
  Zahiri, Reza; Lafontaine, J. Donald; Schmidt, B. Christian; deWaard, Jeremy R.; Zakharov, Evgeny V.; Hebert, Paul D. N. A Transcontinental Challenge — A Test of DNA Barcode Performance for 1,541 Species of Canadian Noctuoidea (Lepidoptera) PLoS ONE ;9(3):e92797 (PDF)
  Reza Zahiri, J. Donald Lafontaine, B. Christian Schmidt, Jeremy R. deWaard, Evgeny V. Zakharov, Paul D. N. Hebert Probing planetary biodiversity with DNA barcodes: The Noctuoidea of North America PLoS ONE 2017-06-01;12(6):0-0 (PDF)
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: USLEP842-10.COI-5P GenBank Accession: HQ583890
  Last Updated: 2021-11-30 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACTTTATATTTTATTTTTGGAATTTGAGCAGGAATAGTAGGAACATCTTTAAGTTTATTAATTCGAGCAGAATT
AGGTAATCCTGGATCATTAATTGGTGATGATCAAATTTATAATACTATTGTAACAGCTCATGCTTTTATTATAAT
TTTTTTTATAGTTATACCTATTATAATTGGAGGATTTGGAAATTGATTAGTTCCTCTTATATTAGGAGCTCCAGA
TATAGCTTTTCCTCGAATAAATAACATAAGTTTTTGATTACTTCCACCTTCACTTACCCTACTTATTTCAAGAAG
AATTGTAGAAAATGGAGCAGGAACTGGATGAACAGTTTATCCCCCTCTTTCATCAAATATTGCTCATGGAGGAAG
ATCTGTTGATTTAGCTATTTTTTCTTTACATTTAGCTGGAATTTCATCTATTTTAGGAGCAATTAATTTTATTAC
AACTATTATTAATATACGATTAAATAATTTATCATTTGATCAAATACCATTATTTGTTTGAGCTGTTGGAATTAC
TGCATTTTTATTACTCCTTTCTTTACCAGTTTTAGCTGGAGCTATTACTATATTATTAACTGATCGTAATTTAAA
TACATCATTTTTTGATCCTGCTGGAGGAGGAGATCCAATTCTTTATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRLNNLSFDQMPLFVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
627 LepF1 / LepR1
LepF1
Forward high qual 2010-08-26  
633 LepF1 / LepR1
LepR1
Reverse high qual 2010-08-26  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2010)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Centre for Biodiversity Genomics
Sequencing Center:
Photography: Alison Forde, Centre for Biodiversity Genomics
Collectors: Biobus 2010
Specimen Identification:
Project Manager: CBG Collections Unit
Sequencing Support: International Barcode of Life (WG1.9)