Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For TXLEP891-19     Back to Search: Records
  IDENTIFIERS:
  Sample ID: CCDB-34609 D06 Museum ID: RCASH
  Field ID: 19ashD30 Collection Code:
  Deposited In: Private Collection of Ann S. Hendrickson
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Ornixolinae
  Class: Insecta Genus: Chileoptilia
  Order: Lepidoptera Species:
  Family: Gracillariidae Subspecies:
  BIN (Cluster ID): BOLD:AAH5502
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex:
  Brief Note: Life Stage: Adult
  Detailed Notes:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2019-04-26
  Province/State: Texas Collectors: Ann Hendrickson
  Region/County: Hill Country of Texas    
  Sector:    
  Exact Site: 1.3 miles NW of Camp Wood    
  Latitude: 29.6822 Elevation: 1459 Meters
  Longitude: -100.029 Elv. Accuracy:
  Coord. Source: Google Earth Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: TXLEP891-19.COI-5P GenBank Accession:
  Last Updated: 2023-02-07 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACATTATATTTTATATTTGGAATTTGAGCTGGAATAGTAGGAACATCTTTAAGTTTATTAATTCGAGCTGAATT
AGGTAATCCAGGATCTTTAATTGGTGATGATCAAATTTATAATACTATTGTAACAGCACATGCTTTTATTATAAT
TTTTTTTATAGTTATACCAATTATAATTGGTGGATTTGGAAATTGATTAGTACCTTTAATATTAGGAGCACCTGA
TATAGCTTTCCCCCGTCTTAATAATATAAGATTTTGATTATTACCACCTTCATTAATACTTTTAATTTCCAGAAG
AATTGTTGAAAATGGTGCAGGAACTGGTTGAACTGTATATCCACCTTTATCATCAAATATTGCTCATGGAGGAAG
TTCAGTAGATTTAGCTATTTTTTCTTTACATTTAGCTGGTATCTCTTCTATTTTAGGTGCAATCAATTTTATTAC
AACTATTATTAATATACGTCCTAATGGAATATCATTTGATAGTATACCATTGTTTGCTTGAGCTGTAGGAATTAC
AGCTTTATTATTATTATTATCTTTACCCGTATTAGCAGGAGCTATTACTATACTATTAACAGATCGAAATTTAAA
TACTTCATTTTTTGATCCTGCTGGAGGGGGAGATCCAATTTTATATCAACATTTATTT
  Amino Acids:  
 
TLYFMFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRLNNMSFWLLPPSLMLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRPNGMSFDSMPLFAWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
638 LepF1 / LepR1
LepR1
Reverse high qual 2019-10-11  
646 LepF1 / LepR1
LepF1
Forward high qual 2019-10-12  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Bold Photography Group, Biodiversity Institute or Ontario

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Bold Photography Group, Biodiversity Institute or Ontario

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Bold Photography Group, Biodiversity Institute or Ontario

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Bold Photography Group, Biodiversity Institute or Ontario

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Private Collection of Ann S. Hendrickson
Sequencing Center:
Photography: Ann S. Hendrickson, Biodiversity Institute or Ontario
Collectors: Ann Hendrickson
Specimen Identification: Ann S. Hendrickson
Project Manager: Evgeny V. Zakharov
Sequencing Support: