Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For QUNOB373-09     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 5653-261108-TX Museum ID:
  Field ID: 5653-261108-TX Collection Code:
  Deposited In: Research Collection of Robert J. Borth
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Calpinae
  Class: Insecta Genus: Coenobela
  Order: Lepidoptera Species: Coenobela sp.
  Family: Erebidae Subspecies:
  BIN (Cluster ID): BOLD:AAG6563
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Coenobela joha Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2008-11-26
  Province/State: Texas Collectors: Ed Knudson
  Region/County: Hidalgo Co    
  Sector:    
  Exact Site: Mission    
  Latitude: Elevation:
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
  PUBLICATIONS:
  Reza Zahiri, J. Donald Lafontaine, B. Christian Schmidt, Jeremy R. deWaard, Evgeny V. Zakharov, Paul D. N. Hebert Probing planetary biodiversity with DNA barcodes: The Noctuoidea of North America PLoS ONE 2017-06-01;12(6):0-0 (PDF)
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: QUNOB373-09.COI-5P GenBank Accession: MF131291
  Last Updated: 2022-08-09 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
CACTTTATATTTTATTTTTGGTATTTGAGCAGGTATAGTAGGAACTTCTCTTAGATTATTAATTCGAGCTGAATT
AGGGAATCCTGGCTCATTAATCGGTGATGATCAAATTTATAATACAATTGTCACAGCGCATGCTTTTATTATAAT
TTTTTTTATGGTCATGCCTATTATAATTGGAGGATTTGGAAATTGATTAGTTCCATTAATATTAGGAGCACCTGA
TATAGCTTTCCCCCGAATAAATAATATAAGATTTTGATTACTACCTCCTTCATTAACCCTTCTAATTTCAAGAAG
AATCGTCGAAAATGGTGCAGGAACAGGATGAACAGTTTACCCCCCTCTTTCCTCCAATATCGCCCATGGAGGTAG
CTCAGTAGATTTAGCTATTTTTTCCCTTCATTTAGCAGGTATTTCTTCGATTTTAGGGGCAATTAATTTCATTAC
TACTATTATTAACATACGATTAAGTAACCTATCTTTTGATCAAATACCTTTATTTGTTTGAGCTGTAGGAATTAC
AGCATTTTTACTTCTTTTATCTCTACCAGTATTAGCAGGAGCAATTACTATACTTTTAACTGATCGAAATCTTAA
TACATCTTTCTTCGACCCAGCTGGTGGAGGAGACCCAATTTTATATCAACATCTTTTT
  Amino Acids:  
 
TLYFIFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRLSNLSFDQMPLFVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
609 LepF1 / LepR1
LepF1
Forward high qual 2009-02-11  
636 LepF1 / LepR1
LepR1
Reverse high qual 2009-02-11  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Unspecified (default): All Rights Reserved 
  License Holder:
Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site: N/A
  Attribution:
Specimen Depository: Research Collection of Robert J. Borth
Sequencing Center:
Photography:
Collectors: Ed Knudson
Specimen Identification: BOLD ID Engine
Project Manager: Evgeny V. Zakharov
Sequencing Support: