Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For MNAA448-07     Back to Search: Records
  IDENTIFIERS:
  Sample ID: CNCLEP00026610 Museum ID: CNCLEP00026610
  Field ID: Collection Code:
  Deposited In: Canadian National Collection of Insects, Arachnids and Nematodes
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Douglasiinae
  Class: Insecta Genus: Tinagma
  Order: Lepidoptera Species: Tinagma dryadis
  Family: Douglasiidae Subspecies:
  BIN (Cluster ID): BOLD:AAB3291
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Tinagma sp 1 Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: Canada Date Collected:
  Province/State: Yukon Territory Collectors: JF Landry & G Pohl
  Region/County:    
  Sector: Whitehorse    
  Exact Site: Grey Mtn summit    
  Latitude: 60.675 Elevation: 1450 Meters
  Longitude: -134.904 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
  PUBLICATIONS:
  Marko Mutanen, Axel Hausmann, Paul D. N. Hebert, Jean-François Landry, Jeremy R. de Waard and Peter Huemer Allopatry as a Gordian Knot for Taxonomists: Patterns of DNA Barcode Divergence in Arctic-Alpine Lepidoptera PLoS ONE 2012-10-11;7(10):e47214 (PDF)
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: MNAA448-07.COI-5P GenBank Accession: JX008304
  Last Updated: 2024-04-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 634 bp
 
AACTTTATATTTTATTTTTGGAATTTGATCTGGTTTATTAGGAACATCACTAAGATTATTAATTCGAGCAGAATT
AGGAAATCCTGGTTCTTTATTAAGAGATGATCAAATTTATAATACTATTGTTACTGCACATGCTTTTATTATAAT
TTTTTTTATAGTTATACCTATTATAATTGGAGGATTTGGTAATTGATTAGTCCCTTTAATAATTGGAGCTCCAGA
TATAGCTTTTCCACGAATAAATAATTTAAGTTTCTGACTACTCCCCCCCTCAATTTCCTTACTAATTTCAAGTAG
TATTGTAGAAATAGGAGCTGGAACAGGATGAACAGTGTACCCCCCACTTTCATCTAATATTGCTCATAGAGGTAG
TTCAGTTGATTTAGCAATTTTCTCATTACATTTAGCAGGAATTTCATCAATTTTAGGAGCAATAAATTTTATTAC
AACTATTATTAATATAAAACCTAATAATATAATATTTGATCAAATATCTTTATTTTCATGAGCAGTAGGAATTAC
TGCTTTATTATTACTATTATCTCTGCCAGTTTTAGCTGGTGCTATTACTATATTACTAACAGATCGAAATCTTAA
TACATCTTTTTTTGATCCTGCAGGAGGTGGAGAT
  Amino Acids:  
 
TLYFIFGIWSGLLGTSLSLLIRAELGNPGSLLSDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMIGAPD
MAFPRMNNLSFWLLPPSISLLISSSIVEMGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAMNFIT
TIINMKPNNMMFDQMSLFSWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGD
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
618 LepF1 / LepR1
LepF1
Forward high qual 2007-03-15  
616 LepF1 / LepR1
LepR1
Reverse high qual 2007-03-15  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2007)
  License Holder:
Jean-Francois Landry, Canadian National Collection

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Canadian National Collection of Insects, Arachnids and Nematodes
Sequencing Center:
Photography: Jean-Francois Landry, Canadian National Collection
Collectors: JF Landry & G Pohl
Specimen Identification: Jean-Francois Landry
Project Manager: Jean-Francois Landry
Sequencing Support: