Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For EHL424-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 1209626A19Jun1998 Museum ID: 1209626A19Jun1998
  Field ID: 1209626A19Jun1998 Collection Code:
  Deposited In: Washington State Department of Agriculture
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Olethreutinae
  Class: Insecta Genus: Orthotaenia
  Order: Lepidoptera Species: Orthotaenia undulana
  Family: Tortricidae Subspecies:
  BIN (Cluster ID): BOLD:AAB4022
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex: M
  Brief Note: Life Stage: A
  Detailed Notes: Genitalia image not for this specimen (incorrect specimen association / lab error)
 
  COLLECTION DATA:
  Country: United States Date Collected: 1998-06-19
  Province/State: Washington Collectors: Eric LAGASA
  Region/County: Thurston    
  Sector: 3 mi NW Tenino    
  Exact Site: 1004 Wright Rd SE    
  Latitude: 46.872 Elevation:
  Longitude: -122.912 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: EHL424-12.COI-5P GenBank Accession:
  Last Updated: 2021-07-27 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 540 bp
 
CTATATTTTATTTTTGGTGTTTGAGCTGGAATAATCGGTACCTCTTTAAGATTATTAATTCGAGCGGAATTAGGA
AATCCCGGCTCACTAATCGGAGATGACCAAATTTATAATACTATTGTAACTGCTCATGCTTTTATTATAATTTTT
TTTATAGTTATACCTATTATAATTGGCGGATTTGGTAATTGATTAGTACCTTTAATATTAGGAGCCCCTGATATA
GCCTTCCCACGAATAAACAACATAAGATTTTGATTATTACCCCCCTCTATTATATTATTAATTTCAAGTAGAATT
GTAGAAAATGGAGCAGGAACAGGATGAACAGTATATCCCCCACTTTCATCAAATATTGCCCATAGTGGAAGATCT
GTAGATCTTGCTATTTTTTCCTTACATTTATCTGGAATTTCATCAATTTTAGGAGCTGTTAATTTTATTACAACT
ATTATTAACATACGACCTAATAATATATCATTAGATCAAATACCCCTATTTGTNTGAGCTGTAGGAATTACAGCT
CTATTATTACTTCTC
  Amino Acids:  
 
LYFIFGVWAGMIGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDM
AFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLSGISSILGAVNFITT
IINMRPNNMSLDQMPLFXWAVGITALLLLL
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
507 LepF1 / LepR1
LepF1
Forward low qual 2012-06-19  
536 LepF1 / LepR1
LepR1
Reverse med qual 2012-06-19  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Eric LaGasa, Washington State Department of Agriculture

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Eric LaGasa, Washington State Department of Agriculture

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Washington State Department of Agriculture
Sequencing Center:
Photography: , Washington State Department of Agriculture
Collectors: Eric LAGASA
Specimen Identification: Paul Hebert
Project Manager: Chris Looney
Sequencing Support: International Barcode of Life (WG1.9)