Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For ABLCU072-09     Back to Search: Records
  IDENTIFIERS:
  Sample ID: CSU-CPG-LEP001072 Museum ID: CSU-CPG-LEP001072
  Field ID: Collection Code:
  Deposited In: Colorado State University, C. P. Gillette Museum of Arthropod Diversity
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Theclinae
  Class: Insecta Genus: Callophrys
  Order: Lepidoptera Species: Callophrys johnsoni
  Family: Lycaenidae Subspecies:
  BIN (Cluster ID): BOLD:AAD6998
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Life Stage: A
  Detailed Notes: Vis. Cyanotus cordulatus
 
  COLLECTION DATA:
  Country: United States Date Collected: 2003-06-28
  Province/State: California Collectors: P. & E.Opler
  Region/County: Plumas Co.    
  Sector: Gold Lake Lodge    
  Exact Site:    
  Latitude: 39.6933 Elevation:
  Longitude: -120.658 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: ABLCU072-09.COI-5P GenBank Accession: GU685581
  Last Updated: 2022-08-09 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACTTTATATTTTATTTTTGGAATTTGAGCAGGAATATTAGGAACATCTTTAAGAATTTTAATTCGAATAGAATT
AGGAATACCTGGATCTTTAATTGGTGATGATCAAATTTATAATACTATTGTAACTGCTCATGCTTTTATTATAAT
TTTTTTTATAGTTATACCTATTATAATTGGAGGATTTGGAAATTGATTAGTACCATTAATATTAGGAGCTCCAGA
CATAGCATTTCCACGAATAAATAATATAAGATTTTGATTATTACCTCCTTCATTAATATTATTAATTTCAAGAAG
AATTGTAGAAAATGGTGCAGGAACAGGATGAACGGTTTACCCCCCACTATCATCAAATATTGCACATGGAGGATC
ATCAGTTGATTTAGCTATTTTTTCTCTTCATTTAGCTGGAATTTCATCAATTTTAGGAGCTATTAATTTTATTAC
AACTATTATTAATATACGAGTTAATAATTTATCATTTGATCAAATATCATTATTTATTTGAGCTGTAGGTATTAC
AGCTTTATTATTATTATTATCATTACCTGTATTAGCTGGAGCTATTACCATACTATTAACTGATCGAAATTTAAA
TACATCATTTTTTGATCCTGCTGGAGGAGGAGATCCAATTTTATATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWAGMLGTSLSILIRMELGMPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLMLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRVNNLSFDQMSLFIWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
622 LepF1 / LepR1
LepF1
Forward high qual 2009-07-29  
641 LepF1 / LepR1
LepR1
Reverse high qual 2009-07-29  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution (2009)
  License Holder:
Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Colorado State University, C. P. Gillette Museum of Arthropod Diversity
Sequencing Center:
Photography:
Collectors: P. & E.Opler
Specimen Identification: Paul Opler
Project Manager: Paul Opler
Sequencing Support: International Barcode of Life (WG1.9)