Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For TCHDC015-17     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 120176 Museum ID: AL-12
  Field ID: HDHB-18-17 Collection Code:
  Deposited In: The Himalaya Drug Company
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Magnoliophyta Subfamily:
  Class: Magnoliopsida Genus: Garcinia
  Order: Malpighiales Species: Garcinia gummi-gutta
  Family: Clusiaceae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Specimen deposited in Herbarium Reproduction: S
  Tissue Descriptor: Aerial dried plant Sex: F
  Brief Note: Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: India Date Collected: 2017-03-01
  Province/State: Karnataka Collectors: Chirag Reddy
  Region/County: Bangalore North    
  Sector:    
  Exact Site: IIHR station    
  Latitude: Elevation: 861 Meters
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: ITS   [Funding Source: N/A]
  Sequence ID: TCHDC015-17.ITS GenBank Accession: MF409651
  Last Updated: 2022-07-01 Genome: Nuclear
  Locus: Internal Transcribed Spacer 1 and 2
  Nucleotides: 340 bp
 
TGGGGCGAGTCGAGTTTTTGACGCAGTTGCGCCCAAAGCCTTTTGGTTGAGGGCACGTCTGCCTGGGTGTCAACA
AGGTTTGCCCAAACCCCAATTATTGTGGTATTTGGGCGGTTGTTGGCCTCCCGTGCGCCCCTTGCTCGCGGTTGG
CCCAAATATGTGCCTCGTTGATGTTGTACACGGCAATCGGTGGTTTTATAGACCCTCGGATATTGTTGTGCACTC
TCGTCTCATTGGCATTAAAGGCCCTAAAGCAATCATTGCATACTATCATAGCGACCCCAGGTCAGGCGAGACTAC
CCGCTTATTTTAATCACATCAGTAAGCGGAGGAGAAAGGT
  Amino Acids:  
 
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: ITS
  Length Pcr Primers Seq Primer Read Status Run Date  
153 PMF1 / ITS4
Forward low qual 2015-06-18  
275 PMF1 / ITS4
Reverse low qual 2015-06-18  
 

  SEQUENCE: rbcLa   [Funding Source: N/A]
  Sequence ID: TCHDC015-17.rbcLa GenBank Accession: MK244688
  Last Updated: 2022-07-01 Genome: Chloroplast
  Locus:
  Nucleotides: 551 bp
 
GGAGTATAAATTGACTTATTATACTCCTGAGTATGAAACAAAAGATACTGATATCTTGGCAGCATTCCGAGTAAC
TCCTCAACCTGGAGTTCCACCCGAAGAAGCAGGAGCTGCAGTAGCTGCGGAATCTTCTACAGGTACATGGACAAC
TGTGTGGACCGATGGGCTTACCAGTCTTGATCGTTATAAAGGACGATGCTACCACATCGAGCCCGTTGCTGGAGA
AGAAAATCAATATATTTGTTATGTAGCTTATCCCTTAGACCTTTTTGAAGAAGGTTCTGTTACTAATATGTTTAC
TTCCATTGTCGGTAATGTATTTGGATTCAAAGCCCTACGCGCTCTACGGCTGGAGGATTTGCGAATCCCTACGGC
TTATACTAAAACTTTCCAAGGCCCGCCTCATGGCATCCAAGTTGAAAGAGATAAATTGAACAAGTATGGCCGCCC
CCTATTGGGCTGTACTATTAAACCTAAATTGGGGCTATCCGCTAAGAATTATGGTAGAGCAGTTTATGAATGTCT
CCGCGGTGGACTTGATTTTAACAACA
  Amino Acids:  
 
EYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGE
ENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYTKTFQGPPHGIQVERDKLNKYGRP
LLGCTIKPKLGLSAKNYGRAVYECLRGGLDFNNX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: rbcLa
  Length Pcr Primers Seq Primer Read Status Run Date  
524 rbcLa-F / rbcLa-R
Forward high qual 2015-06-18  
464 rbcLa-F / rbcLa-R
Reverse med qual 2015-06-18  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Copyright (2017)
  License Holder:
R&D Center, The Himalaya Drug Company

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site: N/A
  Attribution:
Specimen Depository: The Himalaya Drug Company
Sequencing Center:
Photography: Chirag Reddy, The Himalaya Drug Company
Collectors: Chirag Reddy
Specimen Identification:
Project Manager: Gururaj Chalageri
Sequencing Support: