Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For TCHDC014-17     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 120158 Museum ID: AL-390
  Field ID: HDHB-138-12 Collection Code:
  Deposited In: The Himalaya Drug Company
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Magnoliophyta Subfamily:
  Class: Liliopsida Genus: Allium
  Order: Asparagales Species: Allium sativum
  Family: Alliaceae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Deposited in HDC Herbarium Reproduction: S
  Tissue Descriptor: whole plant in dried form Sex: H
  Brief Note: Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: India Date Collected: 2012-05-28
  Province/State: Himachal Pradesh Collectors: Kannan R
  Region/County: Manali    
  Sector:    
  Exact Site:    
  Latitude: Elevation: 1800 Meters
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: rbcLa   [Funding Source: N/A]
  Sequence ID: TCHDC014-17.rbcLa GenBank Accession:
  Last Updated: 2020-07-27 Genome: Chloroplast
  Locus:
  Nucleotides: 548 bp
 
ACAGATTGACTTATTATACTCCTGATTACGAAACCAAAGATACTGATATCTTAGCAGCATTCCGAGTAACTCCTC
AACCCGGAGTTCCCGCTGAAGAAGCAGGGGCTGCGGTAGCCGCCGAATCTTCTACTGGTACCTGGACAACTGTGT
GGACTGATGGACTTACCAGTCTTGATCGTTACAAAGGACGATGCTACCACATTGAGGCCGTTATTGGGGAAGAAA
ATCAATTTATTGCTTATATAGCTTATCCTTTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCA
TTGTGGGTAATGTATTTGGTTTCAAAGCCCTGCGAGCTCTACGTTTAGAGGATCTTCGAATTCCCCCTGCTTATT
CTAAAACTTTCCAAGGCCCGCCTCACGGCATCCAAGTTGAAAGAGATAAATTGAACAAGTATGGACGTCCCCTAT
TGGGATGTACTATTAAACCAAAATTGGGATTATCCGCAAAAAACTACGGTAGAGCAGTTTACGAATGTCTACCCG
GTGGACTTGGAGTTTTACCAACG
  Amino Acids:  
 
RLTYYTPDYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVIGEEN
QFIAYIAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLL
GCTIKPKLGLSAKNYGRAVYECLPGGLGVLPT
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: rbcLa
  Length Pcr Primers Seq Primer Read Status Run Date  
490 rbcLa-F / rbcLa-R
Forward high qual 2016-11-16  
501 rbcLa-F / rbcLa-R
Reverse high qual 2016-11-16  
 

  SEQUENCE: matK   [Funding Source: N/A]
  Sequence ID: TCHDC014-17.matK GenBank Accession:
  Last Updated: 2020-07-27 Genome: Chloroplast
  Locus: Maturase K
  Nucleotides: 795 bp
 
CTTACTCAGAAGAAATCTATTTATGTTTTTTCAAAAGAAAATAAAAGGTTTTTTTGGTTCCTATATAATTCTTAT
GTATTTGAATGCGAAATTTTATTAGTGCTTATTCGTAAACAATCCTCTTATTTACGATTAACTTCTTTTAGAACT
TTTATTGAGCGAATACATTTCTATGGAAAAATAGAACATCTTCAAATTGAATATTTTTTAGTAGTATGTCGTAAC
TATTTTCATAGAACTCTGTGGTTCTTCAAGGATCCTTTCGTGCATTATGTTCGATATCAAGGAAAAGCAATTCTT
GCTTCAAAGGGGACTCATTTTCTGATGAAGAAATGGAAATATCATTTTGTCAATTTTTGGCAATATTATTTTAAC
TTTTGGTCTCAACCATATAGGATCCATATAAATCAATTATCAAACTATTCCTTCCATTTTTTGGGTTATCTTGCA
AGTTTACTAAAAAATTCTTTGGTTATAAGGAATAAAATGTTAAAGAATTCATATCTAATAGATACTATTACTAAT
AAATTTGATACCATAATCCCAGTTATTCTTCTTATTGGATCCTTATCTAAAGGTAAAATTTGTACCGTATCGGGC
CATCCTATTAGTAAGCCAATCTGGGCCGATTTCTCAGATTCTGATATTCTCAATAGATTTGGTCGAATATGTAGA
AATCTTTCTCATTATTACTGTGGATCCTCAAAAAAACAGGGTTTGTATCGAATAAAGTATATACGTCGACTTTCG
TGTGCTAAAACTTTGGCTCGTAAACACAAAGTTCCTAGTACGAAA
  Amino Acids:  
 
LTQKKSIYVFSKENKRFFWFLYNSYVFECEILLVLIRKQSSYLRLTSFRTFIERIHFYGKIEHLQIEYFLVVCRN
YFHRTLWFFKDPFVHYVRYQGKAILASKGTHFLMKKWKYHFVNFWQYYFNFWSQPYRIHINQLSNYSFHFLGYLA
SLLKNSLVIRNKMLKNSYLIDTITNKFDTIIPVILLIGSLSKGKICTVSGHPISKPIWADFSDSDILNRFGRICR
NLSHYYCGSSKKQGLYRIKYIRRLSCAKTLARKHKVPSTK
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: matK
  Length Pcr Primers Seq Primer Read Status Run Date  
816 MatK-1RKIM-f / MatK-3FKIM-r
Forward med qual 2016-11-16  
678 MatK-1RKIM-f / MatK-3FKIM-r
Reverse high qual 2016-11-16  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Copyright (2013)
  License Holder:
R&D Center, The Himalaya Drug Company

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site: N/A
  Attribution:
Specimen Depository: The Himalaya Drug Company
Sequencing Center:
Photography: Kannan R, The Himalaya Drug Company
Collectors: Kannan R
Specimen Identification:
Project Manager: Gururaj Chalageri
Sequencing Support: