Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For TCHDC008-17     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 120157 Museum ID: Al-120
  Field ID: HDHB-192-10 Collection Code:
  Deposited In: The Himalaya Drug Company
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Magnoliophyta Subfamily:
  Class: Magnoliopsida Genus: Bacopa
  Order: Lamiales Species: Bacopa monnieri
  Family: Plantaginaceae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: specimen deposited in Herbarium Reproduction: S
  Tissue Descriptor: aerial dried plant Sex: H
  Brief Note: Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: India Date Collected: 2010-05-10
  Province/State: Karnataka Collectors: Kannan R
  Region/County: Mangalore    
  Sector:    
  Exact Site: Moodabidre    
  Latitude: Elevation: 147 Meters
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: ITS   [Funding Source: N/A]
  Sequence ID: TCHDC008-17.ITS GenBank Accession: MF409649
  Last Updated: 2020-07-27 Genome: Nuclear
  Locus: Internal Transcribed Spacer 1 and 2
  Nucleotides: 387 bp
 
GTGGGCGTGGGTCGCGAGTCTTTGACGCAGTTGCGCCCAAAGCCGTTAGGCCGAGGGCACGTCTGCCTGGGCGTC
ACGCATCGCGTCGCCCCCAACCCAACCCTTGGAAAAAGGGCTTTGAGGTGTTTGGGGGCGGAGACTGACCTCCCG
TGAGCGTTTAGCATGCGGTTGGTCGAAATTAGATCCCGCACTGGCGGAAGTCACGACTAGTGGTGGTTGAAAATT
CAACGCGCATCCTGTCGTGCATCAATTTCGATCCAGTGTTCGGGCATCATCGTACGGAATAAGACCCAACGGCTC
CTCTTCTAAAAATGGGGATGCCTTCGACCGCGACCCCAGGTCAGGCGGGACTACCGCTGAGTTTAAGCATATCAA
TAGTCGGAGGAA
  Amino Acids:  
 
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: ITS
  Length Pcr Primers Seq Primer Read Status Run Date  
333 PMF1 / ITS4
Forward med qual 2015-03-10  
346 PMF1 / ITS4
Reverse med qual 2015-03-10  
 

  SEQUENCE: rbcLa   [Funding Source: N/A]
  Sequence ID: TCHDC008-17.rbcLa GenBank Accession: MK244675
  Last Updated: 2020-07-27 Genome: Chloroplast
  Locus:
  Nucleotides: 479 bp
 
GCAGCATTCCGAGTAACTCCTCAACCTGGAGTTCCGCCTGAGGAAGCAGGGGCTGCAGTGGCTGCTGAATCTTCT
ACTGGGACATGGACAACTGTATGGACCGATGGGCTTACCAGCCTTGACCGTTATAAAGGAAGATGCTACCACATC
GAACCTGTTGCTGGAGAAGAAAATCAATATATATGCTATGTAGCTTACCCCTTAGACCTTTTTGAAGAAGGTTCT
GTTACTAATATGTTTACTTCCATTGTGGGTAATGTATTTGGGTTCAAAGCCCTACGCGCTCTACGTCTGGAGGAT
CTGCGAATTCCTACGGCCTATATTAAAACTTTCCAAGGCCCTCCTCACGGGATCCAAGTTGAGAGAGATAAATTG
AACAAGTATGGTCGTCCCCTATTGGGATGTACTATTAAACCTAAATTGGGGTTATCCGCTAAGAACTACGGTAGA
GCAGTTTATGAATGTCTTCGCGGTGGATT
  Amino Acids:  
 
AAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYICYVAYPLDLFEEGS
VTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: rbcLa
  Length Pcr Primers Seq Primer Read Status Run Date  
515 rbcLa-F / rbcLa-F
Forward med qual 2015-03-10  
501 rbcLa-F / rbcLa-F
Reverse high qual 2015-03-10  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Copyright (2011)
  License Holder:
R&D Center, The Himalaya Drug Company

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site: N/A
  Attribution:
Specimen Depository: The Himalaya Drug Company
Sequencing Center:
Photography: Kannan R, The Himalaya Drug Company
Collectors: Kannan R
Specimen Identification:
Project Manager: Gururaj Chalageri
Sequencing Support: