Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP648017-17     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 17_DHS_AMLA_01A Museum ID:
  Field ID: 17_DHS_AMLA_01A Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Mollusca Subfamily:
  Class: Gastropoda Genus: Crepidula
  Order: Littorinimorpha Species: Crepidula fornicata
  Family: Calyptraeidae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Slipper Shell Life Stage:
  Detailed Notes: ::meta:{"specimen":["Amal Hassan","Lara Almamouri"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Deborah Landry"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Lara Almamouri","Amal Hassan"],"image":["Deborah Landry"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2016-09-05
  Province/State: Maine Collectors: Angela Cicia
  Region/County: Saco Bay    
  Sector:    
  Exact Site: Biddeford Pool    
  Latitude: 43.442 Elevation:
  Longitude: -70.341 Elv. Accuracy:
  Coord. Source: Depth: 5 Meters
  Coord. Accuracy: 30 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP648017-17.COI-5P GenBank Accession:
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 652 bp
 
ATATATTTTATTTGGTATATGATCTGGACTAGTAGGAACAGCTCTAAGATTATTAATCCGAGCTGAACTTGGACA
ACCAGGTGCTCTTCTAGGCGATGATCAACTATACAATGTAATTGTTACAGCACACGCTTTTGTTATAATCTTTTT
TCTAGTAATACCTATAATAATCGGGGGATTTGGTAATTGGTTAGTTCCATTAATGTTAGGTGCTCCTGATATAGC
TTTTCCTCGACTTAATAACATAAGTTTCTGATTATTACCTCCAGCATTATTACTATTGCTATCCTCGGCCGCAGT
AGAAAGAGGAGTCGGGACCGGTTGAACGGTTTATCCTCCTTTGTCTGGAAACCTAGCTCACGCTGGTGGATCTGT
TGATTTAGCAATTTTTTCTTTACATCTTGCTGGTGTTTCATCAATTTTAGGAGCTGTTAATTTTATTACTACTGT
AATTAATATACGTTGACAAGGAGTTCAATTTGAACGACTTCCTTTATTTGTATGATCAGTTAAAATTACAGCCAT
TCTATTATTACTTTCTTTACCAGTGTTAGCCGGAGCAATTACGATGCTTTTAACAGATCGAAATTTTAATACCGC
TTTCTTTGATCCTGCAGGAGGAGGTGATCCTATCTTATATCAGCATTTATTT
  Amino Acids:  
 
YILFGMWSGLVGTALSLLIRAELGQPGALLGDDQLYNVIVTAHAFVMIFFLVMPMMIGGFGNWLVPLMLGAPDMA
FPRLNNMSFWLLPPALLLLLSSAAVESGVGTGWTVYPPLSGNLAHAGGSVDLAIFSLHLAGVSSILGAVNFITTV
INMRWQGVQFERLPLFVWSVKITAILLLLSLPVLAGAITMLLTDRNFNTAFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
672 LCO1490 / HCO2198
M13F-20
Forward high qual 2017-05-30  
643 LCO1490 / HCO2198
M13R
Reverse med qual 2017-05-30  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, Deering High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, Deering High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: , Deering High School
Collectors: Angela Cicia
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: