Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP603004-17     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 17_GHS_DLAL_012A Museum ID:
  Field ID: 17_GHS_DLAL_012A Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Magnoliophyta Subfamily:
  Class: Magnoliopsida Genus: Geranium
  Order: Geraniales Species: Geranium sanguineum
  Family: Geraniaceae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Geranium Life Stage:
  Detailed Notes: ::meta:{"specimen":["Deborah Landry","Aaron Landry"],"image":["Deborah Landry"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Deborah Landry"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Aaron Landry"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2016-09-07
  Province/State: Maine Collectors: Deborah Landry
  Region/County: Yarmouth    
  Sector:    
  Exact Site: Little John Island    
  Latitude: 43.7548 Elevation: 30 Meters
  Longitude: -70.1319 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: 5 Meters Depth Accuracy :
 
 

  SEQUENCE: rbcLa   [Funding Source: N/A]
  Sequence ID: SDP603004-17.rbcLa GenBank Accession:
  Last Updated: 2017-10-16 Genome: Chloroplast
  Locus:
  Nucleotides: 552 bp
 
TAGTGTTGGATTTAAAGCGGGTGTTAAAGACTATAAATTGACTTATTATACTCCTGAGTATGAAACCAAGGATAC
TGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCCGGAGTTCCACCTGAGGAAGCGGGGGCCGCGGTAGCTGC
TGAATCTTCTACCGGTACATGGACAACCGTGTGGACCGATGGGCTTACTAGTCTGGATCGTTACAAAGGACGCTG
CTATCACATCGAGCCCGTTGCTGGAGAAGAAAGTCAATTTATTGCTTATGTAGCTTACCCTTTAGACCTTTTTGA
AGAAGGTTCGGTTACTAATATGTTTACTTCCATCGTGGGTAATGTATTTGGGTTCAAAGCCCTTCGCGCTCTGCG
TCTGGAGGATCTGCGAATCCCTCCTGCTTATGTGAAAACTTTCCAGGGCCCGCCTCACGGCATCCAAGTTGAGAG
AGATAAATTGAACAAGTATGGACGTCCCCTATTGGGATGTACTATTAAACCGAAATTGGGATTGTCCGCTAAGAA
CTACGGTCGAGCAGTTTTTGAATGTCT
  Amino Acids:  
 
SVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRC
YHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVER
DKLNKYGRPLLGCTIKPKLGLSAKNYGRAVFECX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: rbcLa
  Length Pcr Primers Seq Primer Read Status Run Date  
560 rbcLa-F / rbcLa-R
rbcLa-R
Reverse high qual 2016-09-13  
550 rbcLa-F / rbcLa-R
rbcLa-F
Forward high qual 2016-09-13  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, Gorham High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, Gorham High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, Gorham High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: Deborah Landry, Gorham High School
Collectors: Deborah Landry
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: