Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP527019-16     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 16_DHS_015B Museum ID:
  Field ID: 16_DHS_015B Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Chordata Subfamily:
  Class: Actinopterygii Genus: Scomberesox
  Order: Beloniformes Species: Scomberesox saurus
  Family: Scomberesocidae Subspecies:
  BIN (Cluster ID): BOLD:AAB8063
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction: S
  Tissue Descriptor: DNA Sex:
  Brief Note: Atlantic Saury, Landry, DH19-20 Life Stage: Adult
  Detailed Notes: ::meta:{"specimen":["Karen Shibles","Debbie Landry"],"image":["Debbie Landry","Karen Shibles"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Debbie Landry","Karen Shibles"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Debbie Landry","Karen Shibles","Avery Donovan"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2015-09-15
  Province/State: Maine Collectors: James Sulikowski, Angela Cicia
  Region/County: Gulf of Maine    
  Sector:    
  Exact Site: Gulf of Maine    
  Latitude: 43.429 Elevation:
  Longitude: -70.203 Elv. Accuracy:
  Coord. Source: Depth: 5 Meters
  Coord. Accuracy: 1000 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP527019-16.COI-5P GenBank Accession: KX781870
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 652 bp
 
CCTTTATCTAGTATTTGGTGCTTGAGCTGGAATAGTAGGCACTGCCCTAAGCCTTCTTATCCGAGCAGAACTAAG
TCAACCGGGCTCTCTTCTAGGGGATGATCAAATTTATAATGTCATCGTTACAGCCCACGCTTTTGTTATAATTTT
CTTTATAGTAATACCAATTATAATTGGTGGTTTTGGAAACTGACTGATTCCTCTCATGATTGGAGCCCCCGATAT
AGCATTTCCCCGAATAAATAATATAAGTTTTTGACTTCTACCCCCATCCTTCCTACTTCTTCTAGCTTCATCAGG
AGTTGAAGCCGGTGCTGGAACCGGATGAACTGTTTATCCACCCCTAGCTGGAAATTTAGCCCACGCGGGAGCATC
CGTTGATTTAACAATTTTTTCTCTTCATTTAGCAGGTGTATCATCAATTCTAGGAGCTATTAATTTTATTACTAC
TATTATTAACATAAAACCACCTGTAATTTCACAATACCAAACACCTTTATTCGTTTGGGCTGTCCTTATTACAGC
AGTCCTACTCCTCCTCTCTTTACCAGTTTTAGCTGCTGGAATTACTATACTTCTAACAGATCGTAACCTTAATAC
CACCTTCTTTGACCCTGCTGGAGGGGGAGACCCAATTCTCTATCAACACCTA
  Amino Acids:  
 
LYLVFGAWAGMVGTALSLLIRAELSQPGSLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDM
AFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITT
IINMKPPVISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
632 C_FishF1t1 / C_FishR1t1
M13F-20
Forward high qual 2016-05-25  
637 C_FishF1t1 / C_FishR1t1
M13R
Reverse high qual 2016-05-25  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2016)
  License Holder:
Unspecified, Deering High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: Deborah Landry, Deering High School
Collectors: James Sulikowski, Angela Cicia
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: