Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP527005-16     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 16_DHS_002A Museum ID:
  Field ID: 16_DHS_002A Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Varuninae
  Class: Malacostraca Genus: Hemigrapsus
  Order: Decapoda Species: Hemigrapsus sanguineus
  Family: Varunidae Subspecies:
  BIN (Cluster ID): BOLD:AAB4163
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: Asian Crab, Ben, DH1-DH2 Life Stage:
  Detailed Notes: ::meta:{"specimen":["Benjamin Schoenfeld","Rami Zeyada"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Benjamin Schoenfeld","Rami Zeyada","Debbie Landry"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Benjamin Schoenfeld","Rami Zeyada"],"image":["Benjamin Schoenfeld","Rami Zeyada"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2015-09-05
  Province/State: Maine Collectors: Angela Cicia
  Region/County: Saco Bay    
  Sector:    
  Exact Site: Biddeford Pool    
  Latitude: 43.442 Elevation:
  Longitude: -70.341 Elv. Accuracy:
  Coord. Source: Depth: 0.5 Meters
  Coord. Accuracy: 30 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP527005-16.COI-5P GenBank Accession: KX781832
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 513 bp
 
AGGAAGCTTAATTGGTAATGATCAAATCTATAATGTAGTTGTTACAGCTCATGCTTTCGTAATAATTTTCTTTAT
AGTTATGCCAATTATAATTGGAGGATTTGGGAACTGATTAGTACCACTTATACTCGGAGCCCCAGATATAGCCTT
TCCCCGTATAAATAATATAAGATTTTGACTTCTTCCTCCTTCCCTATCCCTCCTTTTAACAAGAAGAATAGTAGA
AAGAGGTGTAGGCACCGGATGAACCGTTTATCCGCCACTTGCAGCTGCTATTGCCCACGCTGGAGCCTCTGTAGA
TCTTGGAATTTTTTCTCTACATCTTGCGGGGGTATCCTCCATTTTAGGGGCTGTTAATTTTATAACAACCGTTAT
CAATATACGCTCCTATGGTATAACAATAGATCAAATACCACTCTTCGTATGAGCTGTATTTATTACTGCCATCCT
CTTGCTTTTATCTTTACCAGTCTTAGCAGGAGCTATCACTATGCTACTCACAGATCGTAATTT
  Amino Acids:  
 
GSLIGNDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLLTSSMVE
SGVGTGWTVYPPLAAAIAHAGASVDLGIFSLHLAGVSSILGAVNFMTTVINMRSYGMTMDQMPLFVWAVFITAIL
LLLSLPVLAGAITMLLTDRNX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
634 LCO1490 / HCO2198
M13F-20
Forward med qual 2016-05-25  
648 LCO1490 / HCO2198
M13R
Reverse med qual 2016-05-25  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2016)
  License Holder:
Unspecified, Deering High School

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: Ben Schoenfeld, Deering High School
Collectors: Angela Cicia
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: