Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP396018-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 15_UNE_SL_001 Museum ID:
  Field ID: 15_UNE_SL_001 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Echinodermata Subfamily:
  Class: Asteroidea Genus: Asterias
  Order: Forcipulatida Species: Asterias forbesi
  Family: Asteriidae Subspecies:
  BIN (Cluster ID): BOLD:AAB6163
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: Starfish, Libby, #11, Session 2 DL01, DL02 Life Stage: Adult
  Detailed Notes: ::meta:{ specimen :[ Sadie Libby ], trace_run_site :[ Generic Commercial Lab ], trace_upload :[ Sadie Libby ], sequencing_run_site :[ Generic Commercial Lab ], sequence_upload :[ Sadie Libby ], image :[ Sadie Libby ]}::endMeta:Seven centimeters long, purple-brown, white dots on surface, one orange dot near center of organism.Five legs
 
  COLLECTION DATA:
  Country: Atlantic Ocean Date Collected: 2015-07-16
  Province/State: Collectors: D. Landry
  Region/County: Casco Bay, Maine    
  Sector:    
  Exact Site: Chebeague Channel    
  Latitude: 43.748 Elevation:
  Longitude: -70.132 Elv. Accuracy:
  Coord. Source: Depth: 7 Meters
  Coord. Accuracy: 5 Meters Depth Accuracy : 5 Meters
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP396018-15.COI-5P GenBank Accession: KU564530
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 653 bp
 
TACTCTTTATCTAATATTTGGAGCTTGAGCTGGTATGATTGGAACTGCTATGAGAGTAATAATTCGTACTGAGCT
TGCACAACCAGGATCTTTACTTCAAGATGATCAAATTTACAAAGTTATAGTAACTGCTCATGCTCTCGTGATGAT
ATTTTTTATGGTAATGCCTATTATGATAGGAGGGTTTGGTAAATGACTAATCCCTCTTATGATAGGAGCTCCAGA
TATGGCATTTCCCCGTATGAAAAAAATGAGATTCTGACTAATTCCTCCTTCCTTTTTACTTCTTCTAGCTTCCGC
TGGGGTTGAAAGGGGAGCAGGCACTGGATGAACGATTTACCCCCCCCTATCTAGAGGATTAGCCCATGCAGGGGG
ATCTGTTGACCTTGCTATTTTTTCCTTACACCTAGCTGGTGCTTCCTCTATTTTAGCCTCTATAAAATTTATTAC
AACAATTATTAAAATGCGCACACCTGGAATGTCTTTTGATCGCCTTCCTCTTTTTGTGTGATCAGTATTTGTAAC
CGCCTTTCTTCTGTTACTCTCCCTCCCTGTCTTAGCTGGAGCTATTACTATGCTCTTGACAGATCGAAAAGTTAA
TACAACTTTTTTTGACCCTGCTGGTGGGGGCGATCCTATTCTCTTCCAACACT
  Amino Acids:  
 
TLYLIFGAWAGMIGTAMSVIIRTELAQPGSLLQDDQIYNVIVTAHALVMIFFMVMPIMIGGFGNWLIPLMIGAPD
MAFPRMNNMSFWLIPPSFLLLLASAGVESGAGTGWTIYPPLSSGLAHAGGSVDLAIFSLHLAGASSILASINFIT
TIINMRTPGMSFDRLPLFVWSVFVTAFLLLLSLPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
653 LCO1490 / HCO2198
M13F-20
Forward high qual 2015-08-12  
666 LCO1490 / HCO2198
M13R
Reverse high qual 2015-08-12  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: , University of New England
Collectors: D. Landry
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: