Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP396012-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 15_UNE_KS_002 Museum ID:
  Field ID: 15_UNE_KS_002 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Criocerinae
  Class: Insecta Genus: Lilioceris
  Order: Coleoptera Species: Lilioceris lilii
  Family: Chrysomelidae Subspecies:
  BIN (Cluster ID): BOLD:AAO1465
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: LilyBeetle, KarenShibles, #2, DL03, DL04 Life Stage: Adult
  Detailed Notes: ::meta:{"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Deborah Landry"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Karen Shibles","Deborah Landry"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2015-08-03
  Province/State: Maine Collectors: Karen Shibles
  Region/County: Westbrook, Maine    
  Sector:    
  Exact Site: Backyard - Crestwood Dr    
  Latitude: 43.702 Elevation:
  Longitude: -70.332 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: 1 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP396012-15.COI-5P GenBank Accession:
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 637 bp
 
GGCATGATCAGGGATGGTCGGAACCTCATTGAGGATATTAATTCGTACAGAACTTGGAAACCCAGGGTCATTAAT
TGGTAATGATCAAATTTATAATGTAATTGTAACAGCCCATGCCTTCATTATAATTTTTTTTATAGTTATACCCAT
TATAATTGGAGGATTCGGAAATTGACTAGTACCCTTAATACTAGGGGCTCCTGACATAGCTTTCCCCCGAATAAA
TAATATAAGATTTTGACTTTTACCCCCCTCTTTAACCCTACTCCTTATAAGAAGAATTGTAGAAAATGGAGCTGG
GACAGGATGAACAGTTTACCCGCCTCTATCCGCAAATTTAGCCCATAATGGAGCATCAGTTGATCTGGCAATTTT
TAGACTTCACCTTGCAGGGATCTCTTCTATTTTAGGTGCAGTAAATTTTATTACTACAATTATAAATATACGCCC
TGAAGGAATAAAAATAGATCGGACTCCTTTATTTGTATGGGCTGTCTTAATTACTGCCATTTTACTTTTACTATC
ACTCCCAGTTTTAGCAGGAGCCATTACAATACTTTTAACAGATCGAAACTTAAACACTTCTTTTTTTGACCCAGC
AAGAGGAGGAGACCCAATTCTTTACCAACATCTTTTC
  Amino Acids:  
 
AWSGMVGTSLSMLIRTELGNPGSLIGNDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMN
NMSFWLLPPSLTLLLMSSIVENGAGTGWTVYPPLSANLAHNGASVDLAIFSLHLAGISSILGAVNFITTIMNMRP
EGMKMDRTPLFVWAVLITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPASGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
665 LCO1490 / HCO2198
M13R
Reverse high qual 2016-11-08  
659 LCO1490 / HCO2198
M13F-20
Forward high qual 2016-11-08  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: K. Shibles, University of New England
Collectors: Karen Shibles
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: