Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP396007-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 15_UNE_CS_001 Museum ID:
  Field ID: 15_UNE_CS_001 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Chordata Subfamily:
  Class: Actinopterygii Genus: Pungitius
  Order: Scorpaeniformes Species: Pungitius pungitius
  Family: Gasterosteidae Subspecies:
  BIN (Cluster ID): BOLD:AAA8317
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered: DNA/Tissue + Photo Reproduction: S
  Tissue Descriptor: DNA Sex:
  Brief Note: Stickleback, CarolynSnow, #5, DL09, DL10 Life Stage:
  Detailed Notes: ::meta:{ specimen :[ Carolyn Snow ], image :[ Carolyn Snow ], trace_run_site :[ Generic Commercial Lab ], trace_upload :[ Carolyn Snow ], sequencing_run_site :[ Generic Commercial Lab ], sequence_upload :[ Carolyn Snow , Ryan Heuss ]}::endMeta:About 3.9 cm long, and .6 cm wide Dark grey back Silver belly Belly and back stripe into each other on sides Thin tail (compared to width) Small side fins Fairly flat body (when on side)
 
  COLLECTION DATA:
  Country: United States Date Collected: 2015-08-03
  Province/State: Maine Collectors: Carolyn Snow
  Region/County: Saco River, Maine    
  Sector:    
  Exact Site: Freddies Beach    
  Latitude: 43.46 Elevation:
  Longitude: -70.379 Elv. Accuracy:
  Coord. Source: Depth: 1 Meters
  Coord. Accuracy: 5 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP396007-15.COI-5P GenBank Accession: KU564523
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 624 bp
 
CCTCTATCTAGTATTCGGTGCCTGGGCCGGCATAGTCGGAACAGCCCTAAGTCTTCTAATTCGAGCTGAGCTCAG
CCAACCTGGGGCCCTCCTAGGTGACGACCAGATCTACAACGTAATTGTTACAGCCCATGCTTTCGTAATAATCTT
CTTTATAGTTATACCAATCATGATCGGAGGTTTCGGTAACTGGCTGATCCCACTGATGATCGGCGCACCCGATAT
GGCGTTCCCGCGGATGAATAACATAAGCTTCTGACTCCTTCCACCCTCTTTCTTACTCCTCCTAGCCTCCTCAGG
GGTTGAAGCCGGGGCGGGTACAGGCTGAACAGTCTACCCTCCTCTATCCGGAAACTTAGCGCACGCAGGTGCCTC
GGTTGACCTAACAATCTTCTCCCTTCACCTAGCAGGAATTTCTTCAATTCTTGGTGCAATTAACTTTATTACCAC
AATTATTAATATGAAACCTCCCGCTATCTCTCAATATCAGACACCCCTATTCGTCTGATCTGTTCTCATCACTGC
AGTCCTACTTCTACTTTCCCTTCCCGTTCTTGCAGCTGGTATTACCATGCTCCTAACAGACCGCAACCTAAACAC
CACCTTCTTTGACCCAGCAGGGGG
  Amino Acids:  
 
LYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDM
AFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLSGNLAHAGASVDLTIFSLHLAGISSILGAINFITT
IINMKPPAISQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
652 FishF2 / FishR2
M13R
Reverse high qual 2015-08-07  
631 FishF2 / FishR2
M13F-20
Forward high qual 2015-08-07  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: Carolyn Snow, University of New England
Collectors: Carolyn Snow
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: