Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP258015-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 14_UNE_MW_001 Museum ID:
  Field ID: 14_UNE_MW_001 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Ischyrocerinae
  Class: Malacostraca Genus: Jassa
  Order: Amphipoda Species: Jassa marmorata
  Family: Ischyroceridae Subspecies:
  BIN (Cluster ID): BOLD:AAA3311
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered:DNA/Tissue+Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: Life Stage:
  Detailed Notes: ::meta:{"specimen":["Mike Weiss"],"image":["Mike Weiss"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Mike Weiss"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Mike Weiss"]}::endMeta:Specimen was 3mm in length.
 
  COLLECTION DATA:
  Country: Atlantic Ocean Date Collected: 2014-08-04
  Province/State: Collectors: M. Weiss
  Region/County: New Meadows River, Maine    
  Sector:    
  Exact Site: Sawyer's Park Boat Ramp    
  Latitude: 43.894 Elevation:
  Longitude: -69.89 Elv. Accuracy:
  Coord. Source: Depth: 1 Meters
  Coord. Accuracy: 50 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP258015-15.COI-5P GenBank Accession: KT601632
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 661 bp
 
GGTACTTTATATTTTATTTTAGGTATTTGGTCTAGATTGGCCGGTACATCTTTAAGTATAATTATCCGAACTGAA
TTAATAGCTCCAAGAAATGTTATTGGAGATGACCAAATTTACAATGTTATTGTCACAGCACACGCTTTTATTATA
ATTTTTTTTATGGTTATACCTGTTATAATTGGAGGTTTTGGTAACTGATTAATTCCTTTAATATTAGGAAGACCA
GATATAGCTTTTCCCCGAATAAATAATATAAGATTTTGATTACTACCCCCCTCATTAACATTACTTCTAATTAGA
AGAATAGTAGAAAGAGGTGTAGGTACAGGTTGAACTGTCTACCCACCTTTAAGAAGAAATATTGGACACCCTGGG
GGTGCCGTTGATTTAGCTATTTTTTCTTTACATTTAGCAGGAGCTTCTTCTATTCTAGGGGCTATTAATTTTATT
TCTACAATTATTAATATACGCCCGGCAGGTATAACTATAGACCGTATACCTTTATTTGTTTGATCTGTATTTATT
ACTGCTATTTTACTATTACTTTCATTACCTGTATTAGCAGGAGCAATTACTATACTTTTAACAGACCGTAATTTA
AACACATCATTTTTTGATCCTTTAGGTGGAGGAGATCCTATCTTATACCAACATTTATTTT
  Amino Acids:  
 
GTLYFILGIWSSLAGTSLSMIIRTELMAPSNVIGDDQIYNVIVTAHAFIMIFFMVMPVMIGGFGNWLIPLMLGSP
DMAFPRMNNMSFWLLPPSLTLLLISSMVESGVGTGWTVYPPLSSNIGHPGGAVDLAIFSLHLAGASSILGAINFI
STIINMRPAGMTMDRMPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPLGGGDPILYQHLFX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
660 VF2 / VR1
M13R
Reverse high qual 2013-08-08  
668 VF2 / VR1
M13F-20
Forward high qual 2013-08-08  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: M. Weiss, University of New England
Collectors: M. Weiss
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: