Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP258011-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 14_UNE_SiMa_001 Museum ID:
  Field ID: 14_UNE_SiMa_001 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Malacostraca Genus: Cancer
  Order: Decapoda Species: Cancer irroratus
  Family: Cancridae Subspecies:
  BIN (Cluster ID): BOLD:AAB7738
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered:DNA/Tissue+Photo Reproduction:
  Tissue Descriptor: DNA Sex: M
  Brief Note: Life Stage:
  Detailed Notes: ::meta:{"specimen":["Sierra Mahoney"],"image":["Sierra Mahoney"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Sierra Mahoney"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Sierra Mahoney"]}::endMeta:redish/brown and a little green, rough, male
 
  COLLECTION DATA:
  Country: Atlantic Ocean Date Collected: 2014-08-04
  Province/State: Collectors: S. Mahoney
  Region/County: Casco Bay, Maine    
  Sector:    
  Exact Site: Littlejohn Channel    
  Latitude: 43.7567 Elevation:
  Longitude: -70.1141 Elv. Accuracy:
  Coord. Source: Depth: 20 Meters
  Coord. Accuracy: 50 Meters Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP258011-15.COI-5P GenBank Accession: KT601629
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 610 bp
 
TGGGGCGTGAGCGGGAATAGTTGGAACCTCTCTTAGATTAATTATCCGTGCTGAACTAGGCCAACCAGGGGCCCT
AATTGGAAACGATCAAATCTATAACGTAGTTGTTACTGCCCATGCTTTTGTTATAATTTTTTTCATAGTAATACC
CATTATAATTGGAGGGTTTGGCAATTGATTAGTCCCTCTTATATTAGGAGCACCTGATATGGCCTTCCCTCGTAT
AAATAACATAAGTTTCTGACTTTTACCTCCCTCCTTAACACTCCTCCTTATAAGAGGGATAGTAGAAAGGGGAGT
TGGAACAGGTTGGACAGTTTACCCCCCTTTAGCAAGGGCAATTGCCCATGCAGGAGCCTCAGTCGATATAGGTAT
TTTCTCTTTACATTTAGCAGGAGTCTCCTCTATCTTAGGGGCCGTTAATTTTATGACGACTGTAATTAACATACG
TTCCTTTGGGATAACTTTAGACCAAATACCACTTTTTGTCTGAGCTGTGTTCATCACTGCCATTCTTTTACTCTT
GTCTCTCCCTGTTTTAGCCGGAGCTATCACTATACTTCTTACTGACCGGAATTTAAACACCTCTTTCTTTGACCC
TGCAGGAGGA
  Amino Acids:  
 
GAWAGMVGTSLSLIIRAELGQPGALIGNDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRM
NNMSFWLLPPSLTLLLMSGMVESGVGTGWTVYPPLASAIAHAGASVDMGIFSLHLAGVSSILGAVNFMTTVINMR
SFGMTLDQMPLFVWAVFITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGG
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
644 LCO1490 / HCO2198
M13R
Reverse high qual 2014-08-07  
664 LCO1490 / HCO2198
M13F-20
Forward high qual 2014-08-07  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: S. Mahoney, University of New England
Collectors: S. Mahoney
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: