Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP258004-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 14_UNE_DR_002 Museum ID:
  Field ID: 14_UNE_DR_002 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Malacostraca Genus: Cancer
  Order: Decapoda Species: Cancer borealis
  Family: Cancridae Subspecies:
  BIN (Cluster ID): BOLD:ACW5563
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered:DNA/Tissue+Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: Life Stage:
  Detailed Notes: ::meta:{"specimen":["Denise Ryan"],"image":["Denise Ryan"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Denise Ryan"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Denise Ryan"]}::endMeta:carapace is 8.4 cm x 5.3 cm. Exoskeleton and appendages were all in tact. The base coloring was a light tan with a darker maroon brown coloring covering most of the carapace.
 
  COLLECTION DATA:
  Country: Atlantic Ocean Date Collected: 2014-07-25
  Province/State: Collectors: C. Landry
  Region/County: Casco Bay, Maine    
  Sector:    
  Exact Site: Littlejohn Channel    
  Latitude: 43.76 Elevation:
  Longitude: -70.12 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP258004-15.COI-5P GenBank Accession: KT073235
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 651 bp
 
TACATTATATTTTATTTTTGGTGCTTGAGCAGGGATNGTTGGNACCTCTCTCAGATTAATTATTCGCGCTGAATT
AGGACAACCGGGAACTCTCATTGGAAATGATCAAATTTACAATGTAGTTGTCACTGCCCATGCTTTTGTTATAAT
TTTTTTTATAGTGATGCCAATTATAATTGGGGGGTTTGGTAATTGATTAGTCCCTCTAATATTAGGAGCACCTGA
TATAGCCTTCCCTCGAATAAATAATATAAGTTTCTGGTTATTACCCCCTTCATTAACCTTACTTCTTATAAGAGG
AATAGTAGAAAGAGGAGTTGGAACAGGTTGAACTGTTTATCCTCCTTTAGCAGGTGCTATTGCCCACGCTGGGGC
TTCAGTAGACATAGGGATTTTTTCTCTTCATTTAGCTGGGGTTTCTTCAATTCTAGGAGCTGTGAATTTTATAAC
AACTGTAATCAATATGCGGTCATTTGGGATAACTTTAGACCAAATACCACTTTTTGTTTGAGCTGTGTTTATTGC
TGCCATCCTTTTACTCTTATCCCTCCCTGTTTTAGCCGGAGCTATTACCATACTCTTAACGGACCGAAACCTAAA
CACTTCCTTCTTTGATCCCGCAGGAGGAGGTGACCCTGTTCTTTACCAACA
  Amino Acids:  
 
TLYFIFGAWAGXVXTSLSLIIRAELGQPGTLIGNDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLLMSGMVESGVGTGWTVYPPLAGAIAHAGASVDMGIFSLHLAGVSSILGAVNFMT
TVINMRSFGMTLDQMPLFVWAVFIAAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPVLYQX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
660 LCO1490 / HCO2198
M13F-20
Forward med qual 2014-08-07  
661 LCO1490 / HCO2198
M13R
Reverse med qual 2014-08-07  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2017)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2015)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: , University of New England D. Ryan, University of New England
Collectors: C. Landry
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: