Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP258001-14     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 14_UNE_SL_001 Museum ID:
  Field ID: 14_UNE_SL_001 Collection Code:
  Deposited In: University of New England
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Malacostraca Genus: Callinectes
  Order: Decapoda Species: Callinectes sapidus
  Family: Portunidae Subspecies:
  BIN (Cluster ID): BOLD:AAB6460
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: E-Vouchered:DNA/Tissue+Photo Reproduction:
  Tissue Descriptor: DNA Sex:
  Brief Note: Life Stage: Adult
  Detailed Notes: ::meta:{"specimen":["Samuel Landry"],"image":["Samuel Landry"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Samuel Landry"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Samuel Landry"]}::endMeta:Blue Crab
 
  COLLECTION DATA:
  Country: United States Date Collected: 2013-06-05
  Province/State: Maine Collectors: Samuel Landry
  Region/County: New Meadows River    
  Sector:    
  Exact Site: Back Cove, West Bath    
  Latitude: 43.8693 Elevation:
  Longitude: -69.8748 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP258001-14.COI-5P GenBank Accession: KT073233
  Last Updated: 2017-10-16 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
TACATTATATTTCATTTTTGGAGCATGATCTGGGATAGTAGGTACATCACTTAGTTTAATCATTCGAGCTGAACT
AGGACAACCTGGAACCCTTATTGGAAACGACCAAATTTATAACGTTGTAGTCACAGCTCACGCCTTTGTTATAAT
TTTCTTCATGGTTATACCTATTATAATTGGAGGATTTGGTAATTGACTAGTTCCCCTTATACTAGGAGCTCCTGA
TATAGCCTTCCCACGAATAAATAACATAAGATTCTGACTCCTACCTCCATCACTAACTCTATTACTAATAAGAGG
TATAGTCGAAAGTGGAGTTGGTACAGGATGAACTGTTTACCCTCCCCTTGCTGCCGCTATTGCTCACGCAGGGGC
CTCAGTTGATCTTGGTATTTTCTCTCTCCACTTAGCTGGTGTATCATCAATTCTAGGGGCTGTTAACTTTATAAC
TACCGTTATTAATATACGTTCATTTGGTATAAGAATAGACCAAATACCTTTATTCGTTTGATCTGTATTTATTAC
CGCTATTCTTCTACTTCTTTCTCTACCTGTATTAGCAGGTGCTATTACTATACTTCTCACTGATCGAAACTTAAA
TACCTCATTCTTCGACCCAGCTGGAGGAGGCGACCCTGTTCTCTACCAACATCTATTC
  Amino Acids:  
 
TLYFIFGAWSGMVGTSLSLIIRAELGQPGTLIGNDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLLMSGMVESGVGTGWTVYPPLAAAIAHAGASVDLGIFSLHLAGVSSILGAVNFMT
TVINMRSFGMSMDQMPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPVLYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
663 LCO1490 / HCO2198
M13R
Reverse high qual 2014-01-30  
659 LCO1490 / HCO2198
M13F-20
Forward high qual 2014-01-30  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2014)
  License Holder:
Unspecified, University of New England

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of New England
Sequencing Center:
Photography: Darcie Couture, University of New England
Collectors: Samuel Landry
Specimen Identification: Deborah Landry
Project Manager: Student Portal Manager
Sequencing Support: