Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For LPOKE406-11     Back to Search: Records
  IDENTIFIERS:
  Sample ID: MDOK-4484 Museum ID: MDOK-4484
  Field ID: MD040911-6 Collection Code:
  Deposited In: Centre for Biodiversity Genomics
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Insecta Genus: Mompha
  Order: Lepidoptera Species: Mompha JFL05
  Family: Momphidae Subspecies:
  BIN (Cluster ID): BOLD:AAE2601
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex:
  Brief Note: Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2011-04-09
  Province/State: Oklahoma Collectors: Mark Dreiling
  Region/County:    
  Sector: Bartlesville    
  Exact Site: 1301 Cherokee Hills Drive    
  Latitude: 36.74 Elevation: 215 Meters
  Longitude: -95.95 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: LPOKE406-11.COI-5P GenBank Accession:
  Last Updated: 2020-10-19 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 638 bp
 
AACACTTTATTTTATTTTTGGAATTTGAGCAGGAATAGTAGGAACTTCCTTAAGATTATTAATTCGAGCTGAATT
AGGAAACCCAGGATCTTTAATTGGAGATGATCAAATTTATAATACTATTGTAACAGCCCATGCATTTATTATAAT
TTTTTTCATAGTAATACCAATTATAATTGGAGGATTTGGAAATTGATTGGTTCCTTTAATATTAGGAGCCCCAGA
TATAGCATTCCCTCGAATAAATAATATAAGATTTTGACTTTTACCCCCCTCTTTAACTTTACTAATCTCAAGAAG
AATTGTAGAAAATGGAGCAGGAACAGGTTGAACCGTTTACCCACCCCTATCTTCCAATATTGCTCATAGTGGAAG
ATCAGTAGACTTAGCTATTTTCTCTTTACATTTAGCTGGAATTTCATCTATTCTAGGAGCAATTAATTTTATTAC
CACAATTATTAATATACGATTAAATAATCTTATATTTGATCAAATACCTTTATTTGTTTGAGCAGTTGGTATTAC
TGCACTATTATTATTATTATCATTACCTGTTTTAGCAGGAGCTATTACTATATTATTAACGGATCGTAATTTAAA
TACTTCATTTTTTGACCCTGCTGGAGGAGGAGACCCAA
  Amino Acids:  
 
TLYFIFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRLNNLMFDQMPLFVWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
499 LepF1 / LepR1
LepF1
Forward med qual 2011-10-31  
633 LepF1 / LepR1
LepR1
Reverse high qual 2011-10-31  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial No Derivatives (2011)
  License Holder:
Mark J. Dreiling, Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Centre for Biodiversity Genomics
Sequencing Center:
Photography: Mark J. Dreiling
Collectors: Mark Dreiling
Specimen Identification: BOLD ID Engine
Project Manager: CBG Collections Unit
Sequencing Support: International Barcode of Life (WG1.9)