Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For LNAUS4022-13     Back to Search: Records
  IDENTIFIERS:
  Sample ID: CCDB-20811-F10 Museum ID: USNM ENT 00905941
  Field ID: Collection Code:
  Deposited In: Smithsonian Institution National Museum of Natural History
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Ennominae
  Class: Insecta Genus: Animomyia
  Order: Lepidoptera Species: Animomyia morta
  Family: Geometridae Subspecies:
  BIN (Cluster ID): BOLD:AAK0928
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Vouchered:Registered Collection Reproduction: S
  Tissue Descriptor: Tissue Sex:
  Brief Note: Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: United States Date Collected: 1989-08-10
  Province/State: Colorado Collectors: R.Fuller
  Region/County: Logan County    
  Sector:    
  Exact Site: Sterling    
  Latitude: Elevation:
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: LNAUS4022-13.COI-5P GenBank Accession:
  Last Updated: 2020-03-30 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
GACATTATATTTTATTTTTGGAATTTGAGCTGGAATATTAGGAACTTCTTTAAGATTACTAATTCGAGCAGAATT
AGGTACTCCAGGCTCATTAATTGGGGATGATCAAATCTATAATACTATTGTTACTGCTCATGCTTTTATTATAAT
TTTTTTTATGGTAATACCTATTATAATTGGGGGATTTGGTAATTGATTAGTTCCCTTAATACTGGGTGCACCAGA
TATAGCTTTCCCACGAATAAATAATATAAGATTTTGATTATTACCCCCCTCTATTATTTTATTAATTTCAAGAAG
AATTGTAGAAAATGGAGCAGGAACTGGATGAACTGTATACCCTCCTTTATCTGCTAATATTGCTCATGGGGGGAG
ATCTGTAGATTTAACTATTTTTTCTCTACATTTAGCGGGTATTTCTTCAATTCTAGGGGCTATTAATTTTATTAC
AACAATTATTAATATACGATTAAATAATTTAACTTTTGATCAAATACCTCTATTCGTTTGAGCAGTGGGAATTAC
AGCATTTTTATTATTATTATCTTTACCTGTATTAGCGGGAGCTATTACTATATTACTTACTGATCGAAATTTAAA
TACATCATTTTTTGATCCTGCTGGAGGGGGGGATCCAATTTTATACCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWAGMLGTSLSLLIRAELGTPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSIILLISSSIVENGAGTGWTVYPPLSANIAHGGSSVDLTIFSLHLAGISSILGAINFIT
TIINMRLNNLTFDQMPLFVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
260 LepF1 / MLepR2
LepF1
Forward high qual 2013-11-14  
367 MLepF1 / LepR1
LepR1
Reverse high qual 2013-11-18  
383 MLepF1 / LepR1
MLepF1
Forward high qual 2013-11-19  
259 LepF1 / MLepR2
MLepR2
Reverse high qual 2013-11-18  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2013)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site: N/A
  Attribution:
Specimen Depository: Smithsonian Institution National Museum of Natural History
Sequencing Center:
Photography: CBG Photography Group, Centre for Biodiversity Genomics
Collectors: R.Fuller
Specimen Identification:
Project Manager: Scott E. Miller
Sequencing Support: International Barcode of Life (WG1.9)