Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For JMMMB454-13     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BIOUG06714-A11 Museum ID: BIOUG06714-A11
  Field ID: JMCA-0456 Collection Code:
  Deposited In: Centre for Biodiversity Genomics
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Olethreutinae
  Class: Insecta Genus: Barbara
  Order: Lepidoptera Species: Barbara colfaxiana
  Family: Tortricidae Subspecies:
  BIN (Cluster ID): BOLD:AAF3527
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex:
  Brief Note: Life Stage: A
  Detailed Notes: Caught by the front porch light
 
  COLLECTION DATA:
  Country: United States Date Collected: 2011-07-06
  Province/State: California Collectors: Jim Moore
  Region/County: Lassen    
  Sector:    
  Exact Site: in Westwood    
  Latitude: 40.2997 Elevation: 1548 Meters
  Longitude: -121.007 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: JMMMB454-13.COI-5P GenBank Accession:
  Last Updated: 2021-02-22 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 549 bp
 
ATTTTTGGTATTTGAGCAGGTATAGTTGGAACTTCTTTA---AGACTTCTAATTCGAGCTGAATTAGGAAACCCC
GGGTCTTTAATTGGAGAT---GATCAAATTTACAATACTATTGTAACTGCCCATGCCTTTATTATAATTTTTTTT
ATAGTTATACCAATTATAATTGGAGGATTTGGAAATTGATTAGTACCTTTAATA---TTAGGAGCTCCTGATATA
GCTTTTCCCCGAATAAATAATATAAGATTTTGACTTTTACCCCCCTCTATTATATTATTAATTTCAAGAAGTATT
GTAGAAAATGGAGCAGGAACAGGATGAACAGTTTACCCACCTTTATCATCTAATATTGCCCATAGAGGTAGTTCT
GTTGATTTA---GCTATTTTTTCTTTACATTTAGCTGGAATTTCTTCAATTTTAGGAGCCGTTAACTTTATTACC
ACTATTATTAATATACGACCAAATAATATAAGTTTAGATCAAATACCCTTATTTGTATGAGCTGTTGGAATTACA
GCACTTTTACTCCTTCTTTCACTT
  Amino Acids:  
 
IFGIWAGMVGTSL-SLLIRAELGNPGSLIGD-DQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLM-LGAPDM
AFPRMNNMSFWLLPPSIMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDL-AIFSLHLAGISSILGAVNFIT
TIINMRPNNMSLDQMPLFVWAVGITALLLLLSL
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
571 LepF1 / LepR1
LepR1
Reverse high qual 2013-10-04  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Centre for Biodiversity Genomics
Sequencing Center:
Photography: Jim Moore, Centre for Biodiversity Genomics
Collectors: Jim Moore
Specimen Identification: Jim M. Moore
Project Manager: Jim M. Moore
Sequencing Support: International Barcode of Life (WG1.9)