Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For JMMMB202-11     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BIOUG00849-A12 Museum ID: BIOUG00849-B02
  Field ID: JMCA-0204 Collection Code:
  Deposited In: Centre for Biodiversity Genomics
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Insecta Genus:
  Order: Lepidoptera Species:
  Family: Subspecies:
  BIN (Cluster ID): BOLD:ABZ4195
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex:
  Brief Note: Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2004-06-03
  Province/State: California Collectors: Jim Moore
  Region/County:    
  Sector:    
  Exact Site:    
  Latitude: 40.297 Elevation: 1548 Meters
  Longitude: -120.996 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: JMMMB202-11.COI-5P GenBank Accession: JN301470-SUPPRESSED
  Last Updated: 2019-12-02 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACATTATATTTTATTTTTGGAATTTGAGCAGGTATAGTAGGAACTTCTTTAAGATTATTAATTCGAGCAGAATT
AGGAAATCCAGGATCTTTAATTGGGGATGATCAAATTTACAATACTATTGTTACAGCACATGCTTTTATTATAAT
TTTTTTCATAGTTATACCAATCATAATCGGAGGATTTGGAAATTGATTAGTTCCATTAATATTAGGAGCCCCAGA
TATAGCATTTCCTCGAATAAATAATATAAGATTTTGACTTCTACCCCCATCATTAACTTTATTAATTTCGAGAAG
AATTGTAGAAAATGGAGCAGGAACTGGATGAACAGTATATCCTCCATTATCTTCTAATATTGCACATGGTGGAAG
TTCAGTAGATTTAGCAATTTTTTCATTACATTTAGCTGGAATTTCATCAATTTTAGGAGCTATTAATTTTATTAC
AACTATTATTAATATACGATTAAATAATATATCTTTTGATCAATTACCATTATTTGTATGAGCAGTAGGTATTAC
AGCATTTTTACTTTTATTATCTTTACCAGTATTAGCAGGAGCTATTACTATATTACTAACTGATCGAAATTTAAA
TACTTCATTTTTTGATCCTGCTGGTGGAGGAGATCCAATTTTATATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRLNNMSFDQLPLFVWAVGITAFLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
612 LepF1 / LepR1
LepF1
Forward high qual 2011-05-03  
633 LepF1 / LepR1
LepR1
Reverse high qual 2011-05-04  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial No Derivatives (2011)
  License Holder:
Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Non-Commercial No Derivatives (2011)
  License Holder:
Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Centre for Biodiversity Genomics
Sequencing Center:
Photography: Jim Moore
Collectors: Jim Moore
Specimen Identification: Paul Hebert
Project Manager: Jim M. Moore
Sequencing Support: International Barcode of Life (WG1.9)