Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For GWORW492-10     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BC EF Lep 01466 Museum ID: BC EF Lep 01466
  Field ID: BC EF Lep 01466 Collection Code:
  Deposited In: Research Collection of Egbert Friedrich
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Insecta Genus:
  Order: Lepidoptera Species:
  Family: Subspecies:
  BIN (Cluster ID): BOLD:AAB5317
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex: F
  Brief Note: Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: Australia Date Collected: 2007-02-02
  Province/State: Queensland Collectors: E. Friedrich
  Region/County:    
  Sector:    
  Exact Site:    
  Latitude: -28.3039 Elevation: 330 Meters
  Longitude: 151.089 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: GWORW492-10.COI-5P GenBank Accession: HM912145-SUPPRESSED
  Last Updated: 2022-05-10 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACTTTATATTTTATTTTTGGAATTTGATCAGGAATAGTAGGAACTTCTCTTAGATTACTTATTCGAGCTGAATT
AGGTAATCCAGGATCATTAATTGGAGATGATCAAATTTATAATACTATTGTTACAGCACATGCTTTTATTATAAT
TTTTTTTATGGTAATACCAATTATAATTGGAGGATTTGGAAATTGACTAGTGCCTTTAATATTAGGAGCCCCAGA
TATAGCTTTTCCACGAATAAATAATATAAGATTTTGACTATTACCCCCCTCATTAATACTTTTAATTTCGAGAAG
AATTGTAGAAAATGGAGCAGGAACTGGATGAACTGTTTACCCCCCTTTATCTTCTAATATTGCTCACAGAGGTAG
CTCTGTTGACTTAGCTATTTTTTCCTTACATTTAGCTGGAATTTCTTCAATTTTAGGAGCAATTAATTTTATTAC
AACAATCATTAACATACGACCTAATATAATATCTTTTGATCAAATACCTTTATTTGTATGAGCAGTTGGAATTAC
CGCATTACTTTTACTATTATCTTTACCAGTTCTTGCTGGAGCAATTACTATACTTTTAACAGACCGTAATTTAAA
TACATCATTTTTTGATCCTGCTGGAGGAGGAGATCCAATTTTATATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWSGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLMLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRPNMMSFDQMPLFVWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
638 LepF1 / LepR1
LepR1
Reverse high qual 2010-05-13  
638 LepF1 / LepR1
LepF1
Forward high qual 2010-05-18  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Copyright (2010)
  License Holder:
Egbert Friedrich, Research Collection of Egbert Friedrich

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
Copyright (2010)
  License Holder:
Egbert Friedrich, Research Collection of Egbert Friedrich

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Research Collection of Egbert Friedrich
Sequencing Center:
Photography: ZSM Photography Team, Research Collection of Egbert Friedrich
Collectors: E. Friedrich
Specimen Identification: Egbert Friedrich
Project Manager: Axel Hausmann
Sequencing Support: International Barcode of Life (WG1.9)