Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For CMAZA1288-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BIOUG02044-F09 Museum ID: BIOUG02044-F09
  Field ID: 10082044 Collection Code:
  Deposited In: Canadian National Collection of Insects, Arachnids and Nematodes
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Anomologinae
  Class: Insecta Genus: Megacraspedus
  Order: Lepidoptera Species:
  Family: Gelechiidae Subspecies:
  BIN (Cluster ID): BOLD:ABW6361
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex: F
  Brief Note: genitalia MIC 6599 Life Stage: A
  Detailed Notes: transition zone from mesquite grassland to Oak-Juniper woodland
 
  COLLECTION DATA:
  Country: United States Date Collected: 2010-08-20
  Province/State: Arizona Collectors: Charles Melton
  Region/County: Cochise Co.    
  Sector: Miller Canyon, Huachuca Mountains    
  Exact Site: 1.16km West of Hwy 92 on East Miller Canyon Road    
  Latitude: 31.427 Elevation: 1542 Meters
  Longitude: -110.252 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: CMAZA1288-12.COI-5P GenBank Accession:
  Last Updated: 2022-08-09 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACTTTATATTTTATCTTTGGAATTTGAGCTGGATTAGTTGGTACTTCTTTAAGTTTATTAATTCGAGCAGAATT
AGGAAATCCAGGCTCATTAATTGGTGATGATCAAATTTATAATACTATTGTAACTGCTCATGCTTTTATTATAAT
TTTCTTTATAGTTATACCAATTATAATTGGAGGATTTGGTAATTGATTAGTTCCTTTAATACTTGGAGCACCAGA
TATAGCTTTCCCCCGAATAAATAATATAAGTTTTTGATTGCTCCCCCCTTCCTTAACTCTTTTAATCTCAAGAAG
AATAGTTGAAAATGGAGCAGGAACTGGATGAACAGTTTACCCCCCCTTATCCTCTAATATTGCTCACGGAGGAAG
ATCCGTAGATCTTGCAATTTTTTCTTTACATTTAGCTGGAATTTCCTCTATTTTAGGGGCAATTAATTTTATCAC
TACAATTATTAACATAAAAATTAATGGTTTATCCTTTGACCAAATACCTTTATTTGTTTGATCAGTTGGTATTAC
AGCCTTACTTCTTCTTTTATCTTTACCAGTATTAGCGGGAGCTATTACTATATTATTAACTGATCGTAATTTAAA
TACTTCCTTCTTTGACCCCGCCGGAGGAGGAGACCCTATTTTATATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWAGLVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLISSSMVENGAGTGWTVYPPLSSNIAHGGSSVDLAIFSLHLAGISSILGAINFIT
TIINMKINGLSFDQMPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
628 LepF1 / LepR1
LepF1
Forward high qual 2012-04-30  
632 LepF1 / LepR1
LepR1
Reverse high qual 2012-04-30  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution (2012)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Canadian National Collection of Insects, Arachnids and Nematodes
Sequencing Center:
Photography: CBG Photography Group, Centre for Biodiversity Genomics
Collectors: Charles Melton
Specimen Identification: Jean-Francois Landry
Project Manager: CBG Collections Unit
Sequencing Support: International Barcode of Life (WG1.9)