Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For ASIND2167-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: INB0003348077 Museum ID:
  Field ID: INB0003348077 Collection Code:
  Deposited In: Instituto Nacional de Biodiversidad, Costa Rica
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Eristalinae
  Class: Insecta Genus: Ceriana
  Order: Diptera Species: Ceriana macquarti
  Family: Syrphidae Subspecies:
  BIN (Cluster ID): BOLD:AAZ0007
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex: U
  Brief Note: Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: Costa Rica Date Collected: 2000-06-11
  Province/State: Guanacaste Collectors: Briceno Duvalier
  Region/County: Area de conservacion Guanacaste    
  Sector: La Cruz    
  Exact Site: La Cruz, 0.400 Km del Limite del Pque Nal Santa Ro    
  Latitude: 10.9 Elevation:
  Longitude: -85.621 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.6]
  Sequence ID: ASIND2167-12.COI-5P GenBank Accession:
  Last Updated: 2022-07-05 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACTTTATATTTTATTTTTGGAACCTGAGCTGGAATAGTAGGTACTTCTTTAAGTATTTTAATTCGGGCAGAATT
AGGACATCCAGGAGCATTAATTGGAGATGATCAAATTTATAATGTTATTGTAACAGCTCATGCTTTTGTAATAAT
TTTTTTTATAGTAATACCTATTATAATTGGAGGGTTTGGAAATTGATTAGTACCATTAATATTAGGAGCTCCTGA
TATAGCTTTTCCTCGTATAAATAATATAAGTTTTTGACTTCTCCCCCCTTCTTTAACTTTATTATTAGTAAGAAG
TATAGTAGAAACTGGAGCCGGAACAGGATGAACAGTTTATCCTCCTCTTTCTGCAAGTATTGCCCATAGAGGAGC
TTCTGTTGACCTAGCTATTTTCTCTCTTCATTTAGCAGGAATATCATCTATTTTAGGAGCTGTAAATTTTATTAC
AACTGTAATTAATATACGAGCAACAGGAATTTCTTATGACCGAATACCTTTATTTGTGTGATCAGTTGTAATTAC
AGCTTTATTATTATTATTATCTCTCCCAGTATTAGCCGGAGCTATTACTATACTTTTAACTGATCGAAACTTAAA
TACTTCATTTTTTGACCCAGCAGGAGGAGGAGACCCAATTCTTTATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGTWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLLVSSMVETGAGTGWTVYPPLSASIAHSGASVDLAIFSLHLAGMSSILGAVNFIT
TVINMRATGISYDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
361 MLepF1 / C_LepFolR
C_LepFolR
Reverse high qual 2012-12-03  
366 MLepF1 / C_LepFolR
MLepF1
Forward high qual 2012-12-03  
267 C_LepFolF / MLepR2
MLepR2
Reverse high qual 2012-12-03  
267 C_LepFolF / MLepR2
C_LepFolF
Forward high qual 2012-12-04  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Copyright (2012)
  License Holder:
M. Zumbado, Instituto Nacional de Biodiversidad

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Instituto Nacional de Biodiversidad, Costa Rica
Sequencing Center:
Photography: Braulio Hernandez, Instituto Nacional de Biodiversidad
Collectors: Briceno Duvalier
Specimen Identification: Manuel A. Zumbado
Project Manager: Manuel A. Zumbado
Sequencing Support: International Barcode of Life (WG1.6)