Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For ASIND1323-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: INB0003706905 Museum ID:
  Field ID: INB0003706905 Collection Code:
  Deposited In: Instituto Nacional de Biodiversidad, Costa Rica
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Eristalinae
  Class: Insecta Genus: Ornidia
  Order: Diptera Species: Ornidia major
  Family: Syrphidae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction: S
  Tissue Descriptor: Sex: F
  Brief Note: Life Stage: A
  Detailed Notes:
 
  COLLECTION DATA:
  Country: Costa Rica Date Collected: 2003-03-16
  Province/State: Limon Collectors: Arana Ugalde Wilfredo
  Region/County: Area de conservacion La Amistad Caribe    
  Sector: Limon    
  Exact Site: Valle de la Estrella, Reserva Biol Hitoy Cerere, S    
  Latitude: 9.661 Elevation: 560 Meters
  Longitude: -83.031 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: ASIND1323-12.COI-5P GenBank Accession:
  Last Updated: 2020-10-19 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 307 bp
 
AACCCTATATTTTATATTTGGAACATGAGCAGGAATAGTGGGTACATCATTAAGAATTTTAATTCGTGCTGAATT
AGGCCACCCAGGAGCATTAATTGGAGATGACCAAATTTATAACGTAATTGTTACAGCTCATGCTTTCGTAATAAT
TTTTTTTATAGTAATACCAATTATAATTGGAGGATTCGGAAATTGACTAGTGCCATTAATATTAGGGGCCCCAGA
TATAGCATTTCCACGAATAAATAATTTAAGTTTCTGATTATTACCTCCTTCTCTTACATTATTATTAGTAAGTAG
TATAGTA
  Amino Acids:  
 
TLYFMFGTWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNLSFWLLPPSLTLLLVSSMV
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
263 C_LepFolF / MLepR2
MLepR2
Reverse high qual 2012-08-15  
254 C_LepFolF / MLepR2
C_LepFolF
Forward high qual 2012-08-14  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Copyright (2012)
  License Holder:
M. Zumbado, Instituto Nacional de Biodiversidad

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Instituto Nacional de Biodiversidad, Costa Rica
Sequencing Center:
Photography: Braulio Hernandez, Instituto Nacional de Biodiversidad
Collectors: Arana Ugalde Wilfredo
Specimen Identification: Manuel A. Zumbado
Project Manager: Manuel A. Zumbado
Sequencing Support: